Lineage for d1axgb1 (1axg B:1-174,B:325-374)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13334Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 13335Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 13363Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 13364Protein Alcohol dehydrogenase [50137] (4 species)
  7. 13368Species Horse (Equus caballus) [TaxId:9796] [50138] (22 PDB entries)
  8. 13397Domain d1axgb1: 1axg B:1-174,B:325-374 [24692]
    Other proteins in same PDB: d1axga2, d1axgb2, d1axgc2, d1axgd2

Details for d1axgb1

PDB Entry: 1axg (more details), 2.5 Å

PDB Description: crystal structure of the val203->ala mutant of liver alcohol dehydrogenase complexed with cofactor nad and inhibitor trifluoroethanol solved to 2.5 angstrom resolution

SCOP Domain Sequences for d1axgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axgb1 b.35.1.2 (B:1-174,B:325-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcXkdsvp
klvadfmakkfaldplithvlpfekinegfdllrsgesirtiltf

SCOP Domain Coordinates for d1axgb1:

Click to download the PDB-style file with coordinates for d1axgb1.
(The format of our PDB-style files is described here.)

Timeline for d1axgb1: