![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
![]() | Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
![]() | Protein Alcohol dehydrogenase [50137] (9 species) contains a Zn-finger subdomain, residues 94-117 |
![]() | Species Horse (Equus caballus) [TaxId:9796] [50138] (52 PDB entries) Uniprot P00327 |
![]() | Domain d1axgb1: 1axg B:1-163,B:340-374 [24692] Other proteins in same PDB: d1axga2, d1axgb2, d1axgc2, d1axgd2 complexed with etf, nad, zn; mutant |
PDB Entry: 1axg (more details), 2.5 Å
SCOPe Domain Sequences for d1axgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axgb1 b.35.1.2 (B:1-163,B:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki negfdllrsgesirtiltf
Timeline for d1axgb1: