Lineage for d3ibvb_ (3ibv B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2333188Family a.118.1.19: Exportin HEAT-like repeat [117002] (2 proteins)
    Pfam PF08389, Pfam PF08767; full length proteins have several extra helices at C-terminus
  6. 2333194Protein Exportin-T (Xpot) [254387] (1 species)
  7. 2333195Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [254820] (1 PDB entry)
  8. 2333197Domain d3ibvb_: 3ibv B: [246902]
    complexed with ca

Details for d3ibvb_

PDB Entry: 3ibv (more details), 3.1 Å

PDB Description: Karyopherin cytosolic state
PDB Compounds: (B:) Exportin-T

SCOPe Domain Sequences for d3ibvb_:

Sequence, based on SEQRES records: (download)

>d3ibvb_ a.118.1.19 (B:) Exportin-T (Xpot) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
msaqdvenaveaaldpsvgpiikqqatdfigslrssstgwkicheifsektkykpstrli
clqtlsekvrewnnesnllelqmirdsvwsyikelsfldepayisnavqhlltllflqly
psnwndffaslqgviaassqsefsnfylkvllsigdeiadslvlktdvqiqkdnlvkdai
randmsdivsfvyemmlaysnaknygtvglclqvyaqwvswininlivnepcmnllysfl
qieelrcaacetmteivnkkmkpleklnllnilnlnlffsksqeqstdpnfdehvaklin
aqgvelvaiksdpselspelkencsfqlynlfpylirylsddydetstavfpflsdllvs
lrkessskelsaslkeflkslleaiikkmkydesqewdddpdseeeaefqemrkklkifq
dtinsidsslfssymysaitsslstaatlspenswqliefalyetyifgeglrgpdaffn
evdksptvlsqilalvttsqvcrhphplvqllymeilvryasffdyesaaipalieyfvg
prgihntnervrprawylfyrfvksikkqvvnytesslamlgdllnisvspvtdmdapvp
tlnssirnsdfnsqlylfetvgvlissgnltpeeqalycdslinaligkanaalssdlsa
leniisvycslmaignfakgfpargseevawlasfnkasdeiflildrmgfnedirgavr
ftsgriinvvgpdmlpkvpqlisillnsidmnelvdvlsfisqlihiykdnmmeitnrml
ptllmrifsslsaapqgtddavkqndlrksyisfilqllnkgfgsilfteenqvyfdpli
nsilhfanlvgepatqkssialvskmvslwggkdgiagfenftlsltplcfempvnpnfn
trdgqslvvlgelaglqkiileklgdiyksylvtvyfptvnfpdvmaseylqals

Sequence, based on observed residues (ATOM records): (download)

>d3ibvb_ a.118.1.19 (B:) Exportin-T (Xpot) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
msaqdvenaveaaldpsvgpiikqqatdfigslrssstgwkicheifsektkykpstrli
clqtlsekvrewnnesnllelqmirdsvwsyikelsfldepayisnavqhlltllflqly
psnwndffaslqgviaassqsefsnfylkvllsigdeiadslvlktdvqiqkdnlvkdai
randmsdivsfvyemmlaysnaknygtvglclqvyaqwvswininlivnepcmnllysfl
qieelrcaacetmteivnkkmkpleklnllnilnlnlffsksqtdpnfdehvaklinaqg
velvaiksdpselspelkencsfqlynlfpylirylsddydetstavfpflsdllvslrk
essskelsaslkeflkslleaiikkmkydesqewdddpdseeeaefqemrkklkifqdti
nsidsslfssymysaitsslstaatlspenswqliefalyetyifgeglrgpdaffndks
ptvlsqilalvttsqvcrhphplvqllymeilvryasffdyesaaipalieyfvgprgih
ntnervrprawylfyrfvksikkqvvnytesslamlgdllnisvspvtdmdapvptlnss
irnsdfnsqlylfetvgvlissgnltpeeqalycdslinaligkanaalssdlseniisv
ycslmaignfakgfpargseevawlasfnkasdeiflildrmgfnedirgavrftsgrii
nvvgpdmlpkvpqlisillnsidmnelvdvlsfisqlihiykdnmmeitnrmlptllmri
fsslsaddavkqndlrksyisfilqllnkgsifteenqvyfdplinsilhfatqkssial
vskmvslgfenftlsltplcfemlvvlgelaglqkiileksylvtvyfptdvmaseylqa
ls

SCOPe Domain Coordinates for d3ibvb_:

Click to download the PDB-style file with coordinates for d3ibvb_.
(The format of our PDB-style files is described here.)

Timeline for d3ibvb_: