Lineage for d3iasv_ (3ias V:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1694109Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 1694110Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 1694194Family e.18.1.2: Nqo4-like [144028] (2 proteins)
    Pfam PF00346; Respiratory-chain NADH dehydrogenase, 49 Kd subunit
  6. 1694201Protein automated matches [254688] (1 species)
    not a true protein
  7. 1694202Species Thermus thermophilus HB8 [TaxId:300852] [255886] (3 PDB entries)
  8. 1694210Domain d3iasv_: 3ias V: [246890]
    Other proteins in same PDB: d3ias11, d3ias12, d3ias13, d3ias2_, d3ias31, d3ias32, d3ias33, d3ias34, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasw_, d3iasx_, d3iasy_, d3iasz_
    automated match to d2fug41
    complexed with ca, fes, fmn, sf4

Details for d3iasv_

PDB Entry: 3ias (more details), 3.15 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 4 mol/ASU, re-refined to 3.15 angstrom resolution
PDB Compounds: (V:) NADH-quinone oxidoreductase subunit 4

SCOPe Domain Sequences for d3iasv_:

Sequence, based on SEQRES records: (download)

>d3iasv_ e.18.1.2 (V:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mtlnvgpqhpsthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprm
dylhsfahdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltp
ffyafreretildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideye
alfaespifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvp
lgergdvfdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeavi
yhfkhytegfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyac
kgeqvpdmvaiiasldpvmgdvdr

Sequence, based on observed residues (ATOM records): (download)

>d3iasv_ e.18.1.2 (V:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mtlnvggvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfa
hdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafre
retildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaesp
ifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergdv
fdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhyt
egfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpd
mvaiiasldpvmgdvdr

SCOPe Domain Coordinates for d3iasv_:

Click to download the PDB-style file with coordinates for d3iasv_.
(The format of our PDB-style files is described here.)

Timeline for d3iasv_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ias11, d3ias12, d3ias13, d3ias2_, d3ias31, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasw_, d3iasx_, d3iasy_, d3iasz_