Lineage for d3iask_ (3ias K:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854369Family c.47.1.21: NQO2-like [142405] (2 proteins)
    complex I 24 kDa subunit; contains 2Fe-2S cluster in the active site; includes extra N-terminal four-helical bundle
    automatically mapped to Pfam PF01257
  6. 1854376Protein automated matches [254686] (1 species)
    not a true protein
  7. 1854377Species Thermus thermophilus HB8 [TaxId:300852] [255884] (3 PDB entries)
  8. 1854384Domain d3iask_: 3ias K: [246872]
    Other proteins in same PDB: d3ias11, d3ias12, d3ias13, d3ias31, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_, d3iasz_
    automated match to d2fug21
    complexed with ca, fes, fmn, sf4

Details for d3iask_

PDB Entry: 3ias (more details), 3.15 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 4 mol/ASU, re-refined to 3.15 angstrom resolution
PDB Compounds: (K:) NADH-quinone oxidoreductase subunit 2

SCOPe Domain Sequences for d3iask_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iask_ c.47.1.21 (K:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve

SCOPe Domain Coordinates for d3iask_:

Click to download the PDB-style file with coordinates for d3iask_.
(The format of our PDB-style files is described here.)

Timeline for d3iask_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ias11, d3ias12, d3ias13, d3ias2_, d3ias31, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_, d3iasz_