Lineage for d3ias33 (3ias 3:247-685)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1875433Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 1875434Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 1875435Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 proteins)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 1875549Protein automated matches [227025] (4 species)
    not a true protein
  7. 1875562Species Thermus thermophilus HB8 [TaxId:300852] [255890] (3 PDB entries)
  8. 1875567Domain d3ias33: 3ias 3:247-685 [246849]
    Other proteins in same PDB: d3ias11, d3ias12, d3ias13, d3ias2_, d3ias31, d3ias32, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iask_, d3iasl1, d3iasl2, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_, d3iasz_
    automated match to d2fug32
    complexed with ca, fes, fmn, sf4

Details for d3ias33

PDB Entry: 3ias (more details), 3.15 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 4 mol/ASU, re-refined to 3.15 angstrom resolution
PDB Compounds: (3:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d3ias33:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ias33 c.81.1.1 (3:247-685) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
wemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghewadqnrl
ktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllaselakalkt
phldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdlkpphry
nhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillallgdkeg
semvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaanarglea
mgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpapt
fyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhleaqkalka
rkvpeamgrlsfrlkelrp

SCOPe Domain Coordinates for d3ias33:

Click to download the PDB-style file with coordinates for d3ias33.
(The format of our PDB-style files is described here.)

Timeline for d3ias33:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ias11, d3ias12, d3ias13, d3ias2_, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_, d3iasz_