| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
| Protein beta-Galactosidase, domain 3 [51510] (3 species) |
| Species Escherichia coli [TaxId:562] [51511] (46 PDB entries) Uniprot P00722 |
| Domain d3iaqd3: 3iaq D:334-625 [246840] Other proteins in same PDB: d3iaqa1, d3iaqa2, d3iaqa4, d3iaqa5, d3iaqb1, d3iaqb2, d3iaqb4, d3iaqb5, d3iaqc1, d3iaqc2, d3iaqc4, d3iaqc5, d3iaqd1, d3iaqd2, d3iaqd4, d3iaqd5 automated match to d1jz7a5 complexed with btb, dms, mg, na |
PDB Entry: 3iaq (more details), 2.7 Å
SCOPe Domain Sequences for d3iaqd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iaqd3 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeanivthgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3iaqd3:
View in 3DDomains from same chain: (mouse over for more information) d3iaqd1, d3iaqd2, d3iaqd4, d3iaqd5 |