Lineage for d3iaqd1 (3iaq D:13-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2383918Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2383919Protein beta-Galactosidase [49804] (3 species)
  7. 2383927Species Escherichia coli [TaxId:562] [49805] (45 PDB entries)
    Uniprot P00722
  8. 2384031Domain d3iaqd1: 3iaq D:13-219 [246838]
    Other proteins in same PDB: d3iaqa2, d3iaqa3, d3iaqa4, d3iaqa5, d3iaqb2, d3iaqb3, d3iaqb4, d3iaqb5, d3iaqc2, d3iaqc3, d3iaqc4, d3iaqc5, d3iaqd2, d3iaqd3, d3iaqd4, d3iaqd5
    automated match to d1f49a3
    complexed with btb, dms, mg, na

Details for d3iaqd1

PDB Entry: 3iaq (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase (e416v)
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3iaqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iaqd1 b.18.1.5 (D:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3iaqd1:

Click to download the PDB-style file with coordinates for d3iaqd1.
(The format of our PDB-style files is described here.)

Timeline for d3iaqd1: