Lineage for d3iaqc5 (3iaq C:731-1023)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391262Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2391263Protein beta-Galactosidase, domain 5 [49996] (3 species)
  7. 2391271Species Escherichia coli [TaxId:562] [49997] (45 PDB entries)
    Uniprot P00722
  8. 2391374Domain d3iaqc5: 3iaq C:731-1023 [246837]
    Other proteins in same PDB: d3iaqa1, d3iaqa2, d3iaqa3, d3iaqa4, d3iaqb1, d3iaqb2, d3iaqb3, d3iaqb4, d3iaqc1, d3iaqc2, d3iaqc3, d3iaqc4, d3iaqd1, d3iaqd2, d3iaqd3, d3iaqd4
    automated match to d1jz8a4
    complexed with btb, dms, mg, na

Details for d3iaqc5

PDB Entry: 3iaq (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase (e416v)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3iaqc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iaqc5 b.30.5.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3iaqc5:

Click to download the PDB-style file with coordinates for d3iaqc5.
(The format of our PDB-style files is described here.)

Timeline for d3iaqc5: