Class b: All beta proteins [48724] (176 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
Protein beta-Galactosidase, domain 5 [49996] (2 species) |
Species Escherichia coli [TaxId:562] [49997] (42 PDB entries) Uniprot P00722 |
Domain d3iaqc5: 3iaq C:731-1023 [246837] Other proteins in same PDB: d3iaqa1, d3iaqa2, d3iaqa3, d3iaqa4, d3iaqb1, d3iaqb2, d3iaqb3, d3iaqb4, d3iaqc1, d3iaqc2, d3iaqc3, d3iaqc4, d3iaqd1, d3iaqd2, d3iaqd3, d3iaqd4 automated match to d1jz8a4 complexed with btb, dms, mg, na |
PDB Entry: 3iaq (more details), 2.7 Å
SCOPe Domain Sequences for d3iaqc5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iaqc5 b.30.5.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3iaqc5:
View in 3D Domains from same chain: (mouse over for more information) d3iaqc1, d3iaqc2, d3iaqc3, d3iaqc4 |