Lineage for d3iaqc2 (3iaq C:220-333)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762431Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2762432Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2762446Species Escherichia coli [TaxId:562] [49306] (46 PDB entries)
    Uniprot P00722
  8. 2762827Domain d3iaqc2: 3iaq C:220-333 [246834]
    Other proteins in same PDB: d3iaqa1, d3iaqa3, d3iaqa5, d3iaqb1, d3iaqb3, d3iaqb5, d3iaqc1, d3iaqc3, d3iaqc5, d3iaqd1, d3iaqd3, d3iaqd5
    automated match to d1jz8a1
    complexed with btb, dms, mg, na

Details for d3iaqc2

PDB Entry: 3iaq (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase (e416v)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3iaqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iaqc2 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d3iaqc2:

Click to download the PDB-style file with coordinates for d3iaqc2.
(The format of our PDB-style files is described here.)

Timeline for d3iaqc2: