Lineage for d3iaqb3 (3iaq B:334-625)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439329Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2439337Species Escherichia coli [TaxId:562] [51511] (45 PDB entries)
    Uniprot P00722
  8. 2439439Domain d3iaqb3: 3iaq B:334-625 [246830]
    Other proteins in same PDB: d3iaqa1, d3iaqa2, d3iaqa4, d3iaqa5, d3iaqb1, d3iaqb2, d3iaqb4, d3iaqb5, d3iaqc1, d3iaqc2, d3iaqc4, d3iaqc5, d3iaqd1, d3iaqd2, d3iaqd4, d3iaqd5
    automated match to d1jz7a5
    complexed with btb, dms, mg, na

Details for d3iaqb3

PDB Entry: 3iaq (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase (e416v)
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3iaqb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iaqb3 c.1.8.3 (B:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeanivthgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3iaqb3:

Click to download the PDB-style file with coordinates for d3iaqb3.
(The format of our PDB-style files is described here.)

Timeline for d3iaqb3: