| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
| Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
| Species Escherichia coli [TaxId:562] [49306] (45 PDB entries) Uniprot P00722 |
| Domain d3iaqa2: 3iaq A:220-333 [246824] Other proteins in same PDB: d3iaqa1, d3iaqa3, d3iaqa5, d3iaqb1, d3iaqb3, d3iaqb5, d3iaqc1, d3iaqc3, d3iaqc5, d3iaqd1, d3iaqd3, d3iaqd5 automated match to d1jz8a1 complexed with btb, dms, mg, na |
PDB Entry: 3iaq (more details), 2.7 Å
SCOPe Domain Sequences for d3iaqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iaqa2 b.1.4.1 (A:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3iaqa2:
View in 3DDomains from same chain: (mouse over for more information) d3iaqa1, d3iaqa3, d3iaqa4, d3iaqa5 |