![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
![]() | Protein beta-Galactosidase [49804] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49805] (46 PDB entries) Uniprot P00722 |
![]() | Domain d3iaqa1: 3iaq A:13-219 [246823] Other proteins in same PDB: d3iaqa2, d3iaqa3, d3iaqa4, d3iaqa5, d3iaqb2, d3iaqb3, d3iaqb4, d3iaqb5, d3iaqc2, d3iaqc3, d3iaqc4, d3iaqc5, d3iaqd2, d3iaqd3, d3iaqd4, d3iaqd5 automated match to d1f49a3 complexed with btb, dms, mg, na |
PDB Entry: 3iaq (more details), 2.7 Å
SCOPe Domain Sequences for d3iaqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iaqa1 b.18.1.5 (A:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3iaqa1:
![]() Domains from same chain: (mouse over for more information) d3iaqa2, d3iaqa3, d3iaqa4, d3iaqa5 |