Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein beta-Galactosidase, domain 3 [51510] (3 species) |
Species Escherichia coli [TaxId:562] [51511] (45 PDB entries) Uniprot P00722 |
Domain d3iapd3: 3iap D:334-625 [246820] Other proteins in same PDB: d3iapa1, d3iapa2, d3iapa4, d3iapa5, d3iapb1, d3iapb2, d3iapb4, d3iapb5, d3iapc1, d3iapc2, d3iapc4, d3iapc5, d3iapd1, d3iapd2, d3iapd4, d3iapd5 automated match to d1jz7a5 complexed with btb, dms, mg, na |
PDB Entry: 3iap (more details), 2 Å
SCOPe Domain Sequences for d3iapd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iapd3 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniqthgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3iapd3:
View in 3D Domains from same chain: (mouse over for more information) d3iapd1, d3iapd2, d3iapd4, d3iapd5 |