| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
| Protein beta-Galactosidase [49804] (3 species) |
| Species Escherichia coli [TaxId:562] [49805] (46 PDB entries) Uniprot P00722 |
| Domain d3iapd1: 3iap D:13-219 [246818] Other proteins in same PDB: d3iapa2, d3iapa3, d3iapa4, d3iapa5, d3iapb2, d3iapb3, d3iapb4, d3iapb5, d3iapc2, d3iapc3, d3iapc4, d3iapc5, d3iapd2, d3iapd3, d3iapd4, d3iapd5 automated match to d1f49a3 complexed with btb, dms, mg, na |
PDB Entry: 3iap (more details), 2 Å
SCOPe Domain Sequences for d3iapd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iapd1 b.18.1.5 (D:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3iapd1:
View in 3DDomains from same chain: (mouse over for more information) d3iapd2, d3iapd3, d3iapd4, d3iapd5 |