Lineage for d3iapc5 (3iap C:731-1023)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391262Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2391263Protein beta-Galactosidase, domain 5 [49996] (3 species)
  7. 2391271Species Escherichia coli [TaxId:562] [49997] (45 PDB entries)
    Uniprot P00722
  8. 2391378Domain d3iapc5: 3iap C:731-1023 [246817]
    Other proteins in same PDB: d3iapa1, d3iapa2, d3iapa3, d3iapa4, d3iapb1, d3iapb2, d3iapb3, d3iapb4, d3iapc1, d3iapc2, d3iapc3, d3iapc4, d3iapd1, d3iapd2, d3iapd3, d3iapd4
    automated match to d1jz8a4
    complexed with btb, dms, mg, na

Details for d3iapc5

PDB Entry: 3iap (more details), 2 Å

PDB Description: e. coli (lacz) beta-galactosidase (e416q)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3iapc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iapc5 b.30.5.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3iapc5:

Click to download the PDB-style file with coordinates for d3iapc5.
(The format of our PDB-style files is described here.)

Timeline for d3iapc5: