![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
![]() | Domain d3iapc2: 3iap C:220-333 [246814] Other proteins in same PDB: d3iapa1, d3iapa3, d3iapa5, d3iapb1, d3iapb3, d3iapb5, d3iapc1, d3iapc3, d3iapc5, d3iapd1, d3iapd3, d3iapd5 automated match to d1jz8a1 complexed with btb, dms, mg, na |
PDB Entry: 3iap (more details), 2 Å
SCOPe Domain Sequences for d3iapc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iapc2 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3iapc2:
![]() Domains from same chain: (mouse over for more information) d3iapc1, d3iapc3, d3iapc4, d3iapc5 |