SCOPe 2.05: Domain d3iapb5: 3iap B:731-1023

Lineage for d3iapb5 (3iap B:731-1023)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
   automatically mapped to Pfam PF02929

6. Protein beta-Galactosidase, domain 5 [49996] (2 species)

7. Species Escherichia coli [TaxId:562] [49997] (42 PDB entries)
   Uniprot P00722

8. Domain d3iapb5: 3iap B:731-1023 [246812]
   Other proteins in same PDB: d3iapa1, d3iapa2, d3iapa3, d3iapa4, d3iapb1, d3iapb2, d3iapb3, d3iapb4, d3iapc1, d3iapc2, d3iapc3, d3iapc4, d3iapd1, d3iapd2, d3iapd3, d3iapd4
   automated match to d1jz8a4
   complexed with btb, dms, mg, na

Details for d3iapb5

PDB Entry: 3iap, 2 Å

PDB Description: e. coli (lacz) beta-galactosidase (e416q)

PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3iapb5:

Sequence; same for both SEQRES and ATOM records:

>d3iapb5 b.30.5.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

Timeline for d3iapb5:

• d3iapb5 first appeared in SCOPe 2.04
  
• d3iapb5 appears in SCOPe 2.06
  
• d3iapb5 appears in the current release, SCOPe 2.08