![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
![]() | Protein beta-Galactosidase, domain 5 [49996] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [49997] (46 PDB entries) Uniprot P00722 |
![]() | Domain d3iapb5: 3iap B:731-1023 [246812] Other proteins in same PDB: d3iapa1, d3iapa2, d3iapa3, d3iapa4, d3iapb1, d3iapb2, d3iapb3, d3iapb4, d3iapc1, d3iapc2, d3iapc3, d3iapc4, d3iapd1, d3iapd2, d3iapd3, d3iapd4 automated match to d1jz8a4 complexed with btb, dms, mg, na |
PDB Entry: 3iap (more details), 2 Å
SCOPe Domain Sequences for d3iapb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iapb5 b.30.5.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3iapb5:
![]() Domains from same chain: (mouse over for more information) d3iapb1, d3iapb2, d3iapb3, d3iapb4 |