SCOP 1.57: Domain d1axea1: 1axe A:1-174,A:325-374

Lineage for d1axea1 (1axe A:1-174,A:325-374)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)

6. Protein Alcohol dehydrogenase [50137] (4 species)

7. Species Horse (Equus caballus) [TaxId:9796] [50138] (26 PDB entries)

8. Domain d1axea1: 1axe A:1-174,A:325-374 [24681]
   Other proteins in same PDB: d1axea2, d1axeb2

Details for d1axea1

PDB Entry: 1axe, 2 Å

PDB Description: crystal structure of the active-site mutant phe93->trp of horse liver alcohol dehydrogenase in complex with nad and inhibitor trifluoroethanol

SCOP Domain Sequences for d1axea1:

Sequence; same for both SEQRES and ATOM records:

>d1axea1 b.35.1.2 (A:1-174,A:325-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplwtpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcXkdsvp
klvadfmakkfaldplithvlpfekinegfdllrsgesirtiltf

Timeline for d1axea1:

• d1axea1 first appeared (with stable ids) in SCOP 1.55
  
• d1axea1 appears in SCOP 1.59
  
• d1axea1 appears in the current release, SCOPe 2.08