| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
| Protein beta-Galactosidase, domain 3 [51510] (3 species) |
| Species Escherichia coli [TaxId:562] [51511] (46 PDB entries) Uniprot P00722 |
| Domain d3iapa3: 3iap A:334-625 [246805] Other proteins in same PDB: d3iapa1, d3iapa2, d3iapa4, d3iapa5, d3iapb1, d3iapb2, d3iapb4, d3iapb5, d3iapc1, d3iapc2, d3iapc4, d3iapc5, d3iapd1, d3iapd2, d3iapd4, d3iapd5 automated match to d1jz7a5 complexed with btb, dms, mg, na |
PDB Entry: 3iap (more details), 2 Å
SCOPe Domain Sequences for d3iapa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iapa3 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniqthgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3iapa3:
View in 3DDomains from same chain: (mouse over for more information) d3iapa1, d3iapa2, d3iapa4, d3iapa5 |