Lineage for d3iamg_ (3iam G:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906288Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1906422Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1906606Protein automated matches [254689] (1 species)
    not a true protein
  7. 1906607Species Thermus thermophilus HB8 [TaxId:300852] [255887] (3 PDB entries)
  8. 1906609Domain d3iamg_: 3iam G: [246801]
    Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamh_
    automated match to d2fug91
    complexed with ca, fes, fmn, mg, nai, sf4

Details for d3iamg_

PDB Entry: 3iam (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH
PDB Compounds: (G:) NADH-quinone oxidoreductase subunit 9

SCOPe Domain Sequences for d3iamg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iamg_ d.58.1.5 (G:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
qrreakrtgkpvkvgyvvpyvrpelegfkapteg

SCOPe Domain Coordinates for d3iamg_:

Click to download the PDB-style file with coordinates for d3iamg_.
(The format of our PDB-style files is described here.)

Timeline for d3iamg_: