Lineage for d1btod1 (1bto D:1-174,D:325-374)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.35: GroES-like [50128] (2 superfamilies) Superfamily b.35.1: GroES-like [50129] (2 families) 
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins) Protein Alcohol dehydrogenase [50137] (4 species) Species Horse (Equus caballus) [TaxId:9796] [50138] (26 PDB entries) 
Domain d1btod1: 1bto D:1-174,D:325-374 [24680]
Other proteins in same PDB: d1btoa2, d1btob2, d1btoc2, d1btod2
Details for d1btod1
PDB Entry: 1bto (more details), 2 Å
PDB Description: horse liver alcohol dehydrogenase complexed to nadh and (1s,3r)3-butylthiolane 1-oxide
SCOP Domain Sequences for d1btod1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1btod1 b.35.1.2 (D:1-174,D:325-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcXkdsvp
klvadfmakkfaldplithvlpfekinegfdllrsgesirtiltf
SCOP Domain Coordinates for d1btod1:
Click to download the PDB-style file with coordinates for d1btod1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1btod1:
View in 3D
