Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.0: automated matches [229598] (1 protein) not a true family |
Protein automated matches [229599] (3 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255889] (3 PDB entries) |
Domain d3iamc2: 3iam C:96-246 [246795] Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_ automated match to d2fug34 complexed with ca, fes, fmn, mg, nai, sf4 |
PDB Entry: 3iam (more details), 3.1 Å
SCOPe Domain Sequences for d3iamc2:
Sequence, based on SEQRES records: (download)
>d3iamc2 d.58.1.0 (C:96-246) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} lsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyekyyqkgplelpvyt rfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfiergvhtfigtmd fglpsgfsgnitdicpvgalldltarfrarn
>d3iamc2 d.58.1.0 (C:96-246) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} lsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyekyelpvytrfeftr rhvdkhhplspfvildrercihckrcvryfeevpgdevldfiergvhtfigtmdfglpsg fsgnitdicpvgalldltarfrarn
Timeline for d3iamc2: