Lineage for d3iamc2 (3iam C:96-246)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906288Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1906623Family d.58.1.0: automated matches [229598] (1 protein)
    not a true family
  6. 1906624Protein automated matches [229599] (3 species)
    not a true protein
  7. 1906639Species Thermus thermophilus HB8 [TaxId:300852] [255889] (3 PDB entries)
  8. 1906641Domain d3iamc2: 3iam C:96-246 [246795]
    Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_
    automated match to d2fug34
    complexed with ca, fes, fmn, mg, nai, sf4

Details for d3iamc2

PDB Entry: 3iam (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH
PDB Compounds: (C:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d3iamc2:

Sequence, based on SEQRES records: (download)

>d3iamc2 d.58.1.0 (C:96-246) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
lsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyekyyqkgplelpvyt
rfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfiergvhtfigtmd
fglpsgfsgnitdicpvgalldltarfrarn

Sequence, based on observed residues (ATOM records): (download)

>d3iamc2 d.58.1.0 (C:96-246) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
lsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyekyelpvytrfeftr
rhvdkhhplspfvildrercihckrcvryfeevpgdevldfiergvhtfigtmdfglpsg
fsgnitdicpvgalldltarfrarn

SCOPe Domain Coordinates for d3iamc2:

Click to download the PDB-style file with coordinates for d3iamc2.
(The format of our PDB-style files is described here.)

Timeline for d3iamc2: