Lineage for d3iamc1 (3iam C:1-95)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2541309Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2541310Protein automated matches [191164] (24 species)
    not a true protein
  7. 2541428Species Thermus thermophilus HB8 [TaxId:300852] [255888] (3 PDB entries)
  8. 2541430Domain d3iamc1: 3iam C:1-95 [246794]
    Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_
    automated match to d2fug33
    complexed with ca, fes, fmn, mg, nai, sf4

Details for d3iamc1

PDB Entry: 3iam (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH
PDB Compounds: (C:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d3iamc1:

Sequence, based on SEQRES records: (download)

>d3iamc1 d.15.4.0 (C:1-95) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
gkpllnekgepeiqwqpklaascvtavadgmvvdt

Sequence, based on observed residues (ATOM records): (download)

>d3iamc1 d.15.4.0 (C:1-95) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpiqwqp
klaascvtavadgmvvdt

SCOPe Domain Coordinates for d3iamc1:

Click to download the PDB-style file with coordinates for d3iamc1.
(The format of our PDB-style files is described here.)

Timeline for d3iamc1: