Lineage for d3iamb_ (3iam B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854369Family c.47.1.21: NQO2-like [142405] (2 proteins)
    complex I 24 kDa subunit; contains 2Fe-2S cluster in the active site; includes extra N-terminal four-helical bundle
    automatically mapped to Pfam PF01257
  6. 1854376Protein automated matches [254686] (1 species)
    not a true protein
  7. 1854377Species Thermus thermophilus HB8 [TaxId:300852] [255884] (3 PDB entries)
  8. 1854379Domain d3iamb_: 3iam B: [246793]
    Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_
    automated match to d2fug21
    complexed with ca, fes, fmn, mg, nai, sf4

Details for d3iamb_

PDB Entry: 3iam (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH
PDB Compounds: (B:) NADH-quinone oxidoreductase subunit 2

SCOPe Domain Sequences for d3iamb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iamb_ c.47.1.21 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
gffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevm
gvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqk
veclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve

SCOPe Domain Coordinates for d3iamb_:

Click to download the PDB-style file with coordinates for d3iamb_.
(The format of our PDB-style files is described here.)

Timeline for d3iamb_: