Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.13: Nqo1 middle domain-like [142984] (2 families) possibly evolved from 2Fe-2S ferredoxins; contains no iron-sulfur cluster |
Family d.15.13.0: automated matches [254297] (1 protein) not a true family |
Protein automated matches [254683] (1 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255881] (3 PDB entries) |
Domain d3iama2: 3iam A:250-333 [246791] Other proteins in same PDB: d3iam11, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_ automated match to d2fug13 complexed with ca, fes, fmn, mg, nai, sf4 |
PDB Entry: 3iam (more details), 3.1 Å
SCOPe Domain Sequences for d3iama2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iama2 d.15.13.0 (A:250-333) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} klyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplpfteevldt pmsyehlqakgsmlgtggvilipe
Timeline for d3iama2: