Lineage for d1btoc1 (1bto C:1-163,C:340-374)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538001Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1538002Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1538123Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 1538141Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 1538158Species Horse (Equus caballus) [TaxId:9796] [50138] (40 PDB entries)
    Uniprot P00327
  8. 1538216Domain d1btoc1: 1bto C:1-163,C:340-374 [24679]
    Other proteins in same PDB: d1btoa2, d1btob2, d1btoc2, d1btod2
    complexed with nad, ssb, zn

Details for d1btoc1

PDB Entry: 1bto (more details), 2 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and (1s,3r)3-butylthiolane 1-oxide
PDB Compounds: (C:) liver alcohol dehydrogenase

SCOPe Domain Sequences for d1btoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1btoc1 b.35.1.2 (C:1-163,C:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOPe Domain Coordinates for d1btoc1:

Click to download the PDB-style file with coordinates for d1btoc1.
(The format of our PDB-style files is described here.)

Timeline for d1btoc1: