Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein automated matches [254689] (1 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255887] (3 PDB entries) |
Domain d3iam9_: 3iam 9: [246789] Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamh_ automated match to d2fug91 complexed with ca, fes, fmn, mg, nai, sf4 |
PDB Entry: 3iam (more details), 3.1 Å
SCOPe Domain Sequences for d3iam9_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iam9_ d.58.1.5 (9:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp qrreakrtgkpvkvgyvvpyvrpelegfkapteg
Timeline for d3iam9_: