Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) |
Family d.82.2.2: Nqo15-like [143572] (1 protein) overall structural similarity to the frataxin-like family automatically mapped to Pfam PF11497 |
Protein NADH-quinone oxidoreductase subunit 15, Nqo15 [143573] (1 species) |
Species Thermus thermophilus [TaxId:274] [143574] (5 PDB entries) Uniprot Q5SKZ7 3-129 |
Domain d3iam7_: 3iam 7: [246788] Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_ automated match to d2fug71 complexed with ca, fes, fmn, mg, nai, sf4 |
PDB Entry: 3iam (more details), 3.1 Å
SCOPe Domain Sequences for d3iam7_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iam7_ d.82.2.2 (7:) NADH-quinone oxidoreductase subunit 15, Nqo15 {Thermus thermophilus [TaxId: 274]} asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra realafa
Timeline for d3iam7_: