Class b: All beta proteins [48724] (176 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.0: automated matches [191648] (1 protein) not a true family |
Protein automated matches [191195] (6 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255891] (3 PDB entries) |
Domain d3iam34: 3iam 3:686-777 [246784] Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_ automated match to d2fug31 complexed with ca, fes, fmn, mg, nai, sf4 |
PDB Entry: 3iam (more details), 3.1 Å
SCOPe Domain Sequences for d3iam34:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iam34 b.52.2.0 (3:686-777) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} kerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrvea rvvhredvpkghlylsalgpaaglrvegrvlv
Timeline for d3iam34: