Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily) contains of two similar intertwined domains related by pseudo dyad; duplication core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) molybdopterine enzyme |
Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 proteins) domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase |
Protein automated matches [227025] (4 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255890] (3 PDB entries) |
Domain d3iam33: 3iam 3:247-685 [246783] Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_ automated match to d2fug32 complexed with ca, fes, fmn, mg, nai, sf4 |
PDB Entry: 3iam (more details), 3.1 Å
SCOPe Domain Sequences for d3iam33:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iam33 c.81.1.1 (3:247-685) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} wemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghewadqnrl ktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllaselakalkt phldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdlkpphry nhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillallgdkeg semvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaanarglea mgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpapt fyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhleaqkalka rkvpeamgrlsfrlkelrp
Timeline for d3iam33: