SCOP 1.69: Domain d1btob1: 1bto B:1-163,B:340-374

Lineage for d1btob1 (1bto B:1-163,B:340-374)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (13 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Horse (Equus caballus) [TaxId:9796] [50138] (33 PDB entries)

8. Domain d1btob1: 1bto B:1-163,B:340-374 [24678]
   Other proteins in same PDB: d1btoa2, d1btob2, d1btoc2, d1btod2

Details for d1btob1

PDB Entry: 1bto, 2 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and (1s,3r)3-butylthiolane 1-oxide

SCOP Domain Sequences for d1btob1:

Sequence; same for both SEQRES and ATOM records:

>d1btob1 b.35.1.2 (B:1-163,B:340-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

Timeline for d1btob1:

• d1btob1 first appeared (with stable ids) in SCOP 1.55
  
• d1btob1 appears in SCOP 1.67
  
• d1btob1 appears in SCOP 1.71
  
• d1btob1 appears in the current release, SCOPe 2.08