Lineage for d3iam13 (3iam 1:334-438)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1732376Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (2 families) (S)
    contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end
  5. 1732384Family a.29.12.0: automated matches [254298] (1 protein)
    not a true family
  6. 1732385Protein automated matches [254684] (1 species)
    not a true protein
  7. 1732386Species Thermus thermophilus HB8 [TaxId:300852] [255882] (3 PDB entries)
  8. 1732387Domain d3iam13: 3iam 1:334-438 [246779]
    Other proteins in same PDB: d3iam11, d3iam12, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_
    automated match to d2fug11
    complexed with ca, fes, fmn, mg, nai, sf4

Details for d3iam13

PDB Entry: 3iam (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH
PDB Compounds: (1:) NADH-quinone oxidoreductase subunit 1

SCOPe Domain Sequences for d3iam13:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iam13 a.29.12.0 (1:334-438) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
rvsmvdamwnltrfyahescgkctpcregvagfmvnlfakigtgqgeekdvenleallpl
iegrsfcpladaavwpvkgslrhfkdqylalarekrpvprpslwr

SCOPe Domain Coordinates for d3iam13:

Click to download the PDB-style file with coordinates for d3iam13.
(The format of our PDB-style files is described here.)

Timeline for d3iam13: