Lineage for d3iam12 (3iam 1:250-333)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1895218Superfamily d.15.13: Nqo1 middle domain-like [142984] (2 families) (S)
    possibly evolved from 2Fe-2S ferredoxins; contains no iron-sulfur cluster
  5. 1895226Family d.15.13.0: automated matches [254297] (1 protein)
    not a true family
  6. 1895227Protein automated matches [254683] (1 species)
    not a true protein
  7. 1895228Species Thermus thermophilus HB8 [TaxId:300852] [255881] (3 PDB entries)
  8. 1895229Domain d3iam12: 3iam 1:250-333 [246778]
    Other proteins in same PDB: d3iam11, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_
    automated match to d2fug13
    complexed with ca, fes, fmn, mg, nai, sf4

Details for d3iam12

PDB Entry: 3iam (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH
PDB Compounds: (1:) NADH-quinone oxidoreductase subunit 1

SCOPe Domain Sequences for d3iam12:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iam12 d.15.13.0 (1:250-333) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
klyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplpfteevldt
pmsyehlqakgsmlgtggvilipe

SCOPe Domain Coordinates for d3iam12:

Click to download the PDB-style file with coordinates for d3iam12.
(The format of our PDB-style files is described here.)

Timeline for d3iam12: