Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) |
Family d.82.2.2: Nqo15-like [143572] (1 protein) overall structural similarity to the frataxin-like family automatically mapped to Pfam PF11497 |
Protein NADH-quinone oxidoreductase subunit 15, Nqo15 [143573] (1 species) |
Species Thermus thermophilus [TaxId:274] [143574] (4 PDB entries) Uniprot Q5SKZ7 3-129 |
Domain d3i9vh_: 3i9v H: [246776] Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_ automated match to d2fug71 complexed with ca, fes, fmn, mn, sf4 |
PDB Entry: 3i9v (more details), 3.1 Å
SCOPe Domain Sequences for d3i9vh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i9vh_ d.82.2.2 (H:) NADH-quinone oxidoreductase subunit 15, Nqo15 {Thermus thermophilus [TaxId: 274]} asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra realafa
Timeline for d3i9vh_: