Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein automated matches [254689] (1 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255887] (3 PDB entries) |
Domain d3i9vg_: 3i9v G: [246775] Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vh_ automated match to d2fug91 complexed with ca, fes, fmn, mn, sf4 |
PDB Entry: 3i9v (more details), 3.1 Å
SCOPe Domain Sequences for d3i9vg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i9vg_ d.58.1.5 (G:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp qrreakrtgkpvkvgyvvpyvrpelegfkapteg
Timeline for d3i9vg_: