Lineage for d3i9vf_ (3i9v F:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953691Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 1953692Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 1953815Family e.19.1.2: Nq06-like [144031] (2 proteins)
    Pfam PF01058
  6. 1953822Protein automated matches [254687] (1 species)
    not a true protein
  7. 1953823Species Thermus thermophilus HB8 [TaxId:300852] [255885] (3 PDB entries)
  8. 1953827Domain d3i9vf_: 3i9v F: [246774]
    Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vg_, d3i9vh_
    automated match to d2fug61
    complexed with ca, fes, fmn, mn, sf4

Details for d3i9vf_

PDB Entry: 3i9v (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU
PDB Compounds: (F:) NADH-quinone oxidoreductase subunit 6

SCOPe Domain Sequences for d3i9vf_:

Sequence, based on SEQRES records: (download)

>d3i9vf_ e.19.1.2 (F:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
eregilfttleklvawgrsnslwpatfglaccaiemmastdarndlarfgsevfrasprq
advmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvd
vyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaa

Sequence, based on observed residues (ATOM records): (download)

>d3i9vf_ e.19.1.2 (F:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
eregilfttleklvawgrsnslwpatfglaccaiemmastdarqadvmivagrlskkmap
vmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiya
vmqlqkkvrgqaynergerlppvaa

SCOPe Domain Coordinates for d3i9vf_:

Click to download the PDB-style file with coordinates for d3i9vf_.
(The format of our PDB-style files is described here.)

Timeline for d3i9vf_: