Lineage for d3i9vc4 (3i9v C:686-777)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798408Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 1798462Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 1798647Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 1798648Protein automated matches [191195] (6 species)
    not a true protein
  7. 1798705Species Thermus thermophilus HB8 [TaxId:300852] [255891] (3 PDB entries)
  8. 1798709Domain d3i9vc4: 3i9v C:686-777 [246771]
    Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_
    automated match to d2fug31
    complexed with ca, fes, fmn, mn, sf4

Details for d3i9vc4

PDB Entry: 3i9v (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU
PDB Compounds: (C:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d3i9vc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i9vc4 b.52.2.0 (C:686-777) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
kerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrvea
rvvhredvpkghlylsalgpaaglrvegrvlv

SCOPe Domain Coordinates for d3i9vc4:

Click to download the PDB-style file with coordinates for d3i9vc4.
(The format of our PDB-style files is described here.)

Timeline for d3i9vc4: