Lineage for d3i9vc3 (3i9v C:247-685)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1875433Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 1875434Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 1875435Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 proteins)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 1875549Protein automated matches [227025] (4 species)
    not a true protein
  7. 1875562Species Thermus thermophilus HB8 [TaxId:300852] [255890] (3 PDB entries)
  8. 1875566Domain d3i9vc3: 3i9v C:247-685 [246770]
    Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v31, d3i9v32, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_
    automated match to d2fug32
    complexed with ca, fes, fmn, mn, sf4

Details for d3i9vc3

PDB Entry: 3i9v (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU
PDB Compounds: (C:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d3i9vc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i9vc3 c.81.1.1 (C:247-685) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
wemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghewadqnrl
ktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllaselakalkt
phldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdlkpphry
nhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillallgdkeg
semvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaanarglea
mgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpapt
fyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhleaqkalka
rkvpeamgrlsfrlkelrp

SCOPe Domain Coordinates for d3i9vc3:

Click to download the PDB-style file with coordinates for d3i9vc3.
(The format of our PDB-style files is described here.)

Timeline for d3i9vc3: