Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
Protein automated matches [191164] (14 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255888] (3 PDB entries) |
Domain d3i9vc1: 3i9v C:1-95 [246768] Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_ automated match to d2fug33 complexed with ca, fes, fmn, mn, sf4 |
PDB Entry: 3i9v (more details), 3.1 Å
SCOPe Domain Sequences for d3i9vc1:
Sequence, based on SEQRES records: (download)
>d3i9vc1 d.15.4.0 (C:1-95) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd gkpllnekgepeiqwqpklaascvtavadgmvvdt
>d3i9vc1 d.15.4.0 (C:1-95) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpiqwqp klaascvtavadgmvvdt
Timeline for d3i9vc1: