Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.21: NQO2-like [142405] (2 proteins) complex I 24 kDa subunit; contains 2Fe-2S cluster in the active site; includes extra N-terminal four-helical bundle automatically mapped to Pfam PF01257 |
Protein automated matches [254686] (1 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255884] (3 PDB entries) |
Domain d3i9vb_: 3i9v B: [246767] Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_ automated match to d2fug21 complexed with ca, fes, fmn, mn, sf4 |
PDB Entry: 3i9v (more details), 3.1 Å
SCOPe Domain Sequences for d3i9vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i9vb_ c.47.1.21 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
Timeline for d3i9vb_: