SCOPe 2.07: Domain d3i9v9_: 3i9v 9:

Lineage for d3i9v9_ (3i9v 9:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other

6. Protein automated matches [254689] (2 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [255887] (3 PDB entries)

8. Domain d3i9v9_: 3i9v 9: [246763]
   Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vh_
   automated match to d2fug91
   complexed with ca, fes, fmn, mn, sf4

Details for d3i9v9_

PDB Entry: 3i9v, 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU

PDB Compounds: (9:) NADH-quinone oxidoreductase subunit 9

SCOPe Domain Sequences for d3i9v9_:

Sequence; same for both SEQRES and ATOM records:

>d3i9v9_ d.58.1.5 (9:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
qrreakrtgkpvkvgyvvpyvrpelegfkapteg

Timeline for d3i9v9_:

• d3i9v9_ first appeared in SCOPe 2.04
  
• d3i9v9_ appears in SCOPe 2.06
  
• d3i9v9_ appears in the current release, SCOPe 2.08