Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily) contains of two similar intertwined domains related by pseudo dyad; duplication core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (2 families) molybdopterine enzyme |
Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 proteins) domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase |
Protein automated matches [227025] (5 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255890] (3 PDB entries) |
Domain d3i9v33: 3i9v 3:247-685 [246757] Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v31, d3i9v32, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_ automated match to d2fug32 complexed with ca, fes, fmn, mn, sf4 |
PDB Entry: 3i9v (more details), 3.1 Å
SCOPe Domain Sequences for d3i9v33:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i9v33 c.81.1.1 (3:247-685) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} wemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghewadqnrl ktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllaselakalkt phldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdlkpphry nhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillallgdkeg semvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaanarglea mgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpapt fyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhleaqkalka rkvpeamgrlsfrlkelrp
Timeline for d3i9v33: