SCOPe 2.04: Domain d3i9v13: 3i9v 1:334-438

Lineage for d3i9v13 (3i9v 1:334-438)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (2 families)
   contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end

5. Family a.29.12.0: automated matches [254298] (1 protein)
   not a true family

6. Protein automated matches [254684] (1 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [255882] (3 PDB entries)

8. Domain d3i9v13: 3i9v 1:334-438 [246753]
   Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_
   automated match to d2fug11
   complexed with ca, fes, fmn, mn, sf4

Details for d3i9v13

PDB Entry: 3i9v, 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU

PDB Compounds: (1:) NADH-quinone oxidoreductase subunit 1

SCOPe Domain Sequences for d3i9v13:

Sequence; same for both SEQRES and ATOM records:

>d3i9v13 a.29.12.0 (1:334-438) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
rvsmvdamwnltrfyahescgkctpcregvagfmvnlfakigtgqgeekdvenleallpl
iegrsfcpladaavwpvkgslrhfkdqylalarekrpvprpslwr

Timeline for d3i9v13:

• d3i9v13 is new in SCOPe 2.04-stable
  
• d3i9v13 appears in SCOPe 2.05
  
• d3i9v13 appears in the current release, SCOPe 2.08