![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
![]() | Protein Trypsin [50504] (1 species) |
![]() | Species Streptomyces griseus, strain k1 [TaxId:1911] [50505] (7 PDB entries) |
![]() | Domain d3i78a_: 3i78 A: [246745] automated match to d3beua_ complexed with ben, na, so4 |
PDB Entry: 3i78 (more details), 3 Å
SCOPe Domain Sequences for d3i78a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i78a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} vvggtraaqgefpfmvrlineenegfcggalyaqdivltaahcvsgsgnntsitatggvv dlqsssavkvrstkvlqapgftketygkdwaliklaqpinqptlkiatttaynqgtftva gwganreggsqqryllkanvpfvsdaacrssssfilvanemicagydtkqedtcqgdsgg pmfrkdnadewvqvgivswgegcarkgkygvytevstfasaiasaartl
Timeline for d3i78a_: