SCOP 1.55: Domain d1a71b1: 1a71 B:1-174,B:325-374

Lineage for d1a71b1 (1a71 B:1-174,B:325-374)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)

6. Protein Alcohol dehydrogenase [50137] (4 species)

7. Species Horse (Equus caballus) [TaxId:9796] [50138] (22 PDB entries)

8. Domain d1a71b1: 1a71 B:1-174,B:325-374 [24674]
   Other proteins in same PDB: d1a71a2, d1a71b2

Details for d1a71b1

PDB Entry: 1a71, 2 Å

PDB Description: ternary complex of an active site double mutant of horse liver alcohol dehydrogenase, phe93=>trp, val203=>ala with nad and trifluoroethanol

SCOP Domain Sequences for d1a71b1:

Sequence; same for both SEQRES and ATOM records:

>d1a71b1 b.35.1.2 (B:1-174,B:325-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplwtpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcXkdsvp
klvadfmakkfaldplithvlpfekinegfdllrsgesirtiltf

Timeline for d1a71b1:

• d1a71b1 appears in SCOP 1.57
  
• d1a71b1 appears in the current release, SCOPe 2.08