SCOPe 2.05: Domain d3i6ef2: 3i6e F:133-375

Lineage for d3i6ef2 (3i6e F:133-375)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Ruegeria pomeroyi [TaxId:89184] [255879] (1 PDB entry)

8. Domain d3i6ef2: 3i6e F:133-375 [246738]
   Other proteins in same PDB: d3i6ea1, d3i6eb1, d3i6ec1, d3i6ed1, d3i6ee1, d3i6ef1, d3i6eg1, d3i6eh1
   automated match to d3i6ta2
   complexed with mg, na

Details for d3i6ef2

PDB Entry: 3i6e, 1.7 Å

PDB Description: crystal structure of muconate lactonizing enzyme from ruegeria pomeroyi.

PDB Compounds: (F:) Muconate cycloisomerase I

SCOPe Domain Sequences for d3i6ef2:

Sequence; same for both SEQRES and ATOM records:

>d3i6ef2 c.1.11.0 (F:133-375) automated matches {Ruegeria pomeroyi [TaxId: 89184]}
kcrdtiplscsianpdfdadialmerlradgvgliklktgfrdhafdimrleliardfpe
frvrvdynqgleideavprvldvaqfqpdfieqpvrahhfelmarlrgltdvplladesv
ygpedmvraahegicdgvsikimksggltraqtvariaaahglmayggdmfeaglahlag
thmiaatpeitlgcefyqasyflnediletpfrveagqvivpdgpglgaradpeklehya
vrr

Timeline for d3i6ef2:

• d3i6ef2 first appeared in SCOPe 2.04
  
• d3i6ef2 appears in SCOPe 2.06
  
• d3i6ef2 appears in the current release, SCOPe 2.08