SCOPe 2.02: Domain d1a71a1: 1a71 A:1-163,A:340-374

Lineage for d1a71a1 (1a71 A:1-163,A:340-374)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Horse (Equus caballus) [TaxId:9796] [50138] (36 PDB entries)
   Uniprot P00327

8. Domain d1a71a1: 1a71 A:1-163,A:340-374 [24673]
   Other proteins in same PDB: d1a71a2, d1a71b2
   complexed with etf, nad, zn; mutant

Details for d1a71a1

PDB Entry: 1a71, 2 Å

PDB Description: ternary complex of an active site double mutant of horse liver alcohol dehydrogenase, phe93=>trp, val203=>ala with nad and trifluoroethanol

PDB Compounds: (A:) liver alcohol dehydrogenase

SCOPe Domain Sequences for d1a71a1:

Sequence; same for both SEQRES and ATOM records:

>d1a71a1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplwtpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

Timeline for d1a71a1:

• d1a71a1 first appeared (with stable ids) in SCOP 1.55
  
• d1a71a1 appears in SCOPe 2.01
  
• d1a71a1 appears in SCOPe 2.03
  
• d1a71a1 appears in the current release, SCOPe 2.08